Learn More
Description
Specifications
Specifications
| Antigen | GDF-9 |
| Applications | Western Blot, ELISA, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | GDF9/4261 |
| Conjugate | DyLight 650 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 |
| Host Species | Mouse |
| Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383) |
| Purification Method | Protein A or G purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
