Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB381144

GDF-9 Antibody (GDF9/4261), DyLight 680, Novus Biologicals™
SDP

Catalog No. NB381144 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB381144 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB381144 Supplier Novus Biologicals Supplier No. NBP308362FR
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry (Paraffin)

Specifications

Antigen GDF-9
Applications Western Blot, ELISA, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone GDF9/4261
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Host Species Mouse
Immunogen Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383)
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 2661
Target Species Human
Content And Storage Store at 4°C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.