Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™

GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™
SDP

Catalog No. NB122020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB122020 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB122020 Supplier Novus Biologicals Supplier No. NBP30727320UG
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry-Paraffin.

Specifications

Antigen GDF-9
Applications Western Blot, ELISA, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone GDF9/4261
Concentration 0.2 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml
Formulation 10 mM PBS with 0.05% BSA
Gene Alias GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Host Species Mouse
Immunogen Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9.
Purification Method Protein A or G purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 2661
Target Species Human
Content And Storage Store at 4°C.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.