Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™

Mouse Monoclonal Antibody

$268.00

Specifications

Antigen	GDF-9
Clone	GDF9/4261
Concentration	0.2 mg/ml
Dilution	Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml
Applications	Western Blot, ELISA, Immunohistochemistry (Paraffin)

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB122020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP30727320UG	20 μg	Each of 1 for $268.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry-Paraffin.

Specifications

Antigen	GDF-9
Concentration	0.2 mg/ml
Applications	Western Blot, ELISA, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Cytokine Research
Formulation	10 mM PBS with 0.05% BSA
Gene ID (Entrez)	2661
Isotype	IgG1
Purification Method	Protein A or G purified

Clone	GDF9/4261
Dilution	Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Immunogen	Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9.
Primary or Secondary	Primary
Content And Storage	Store at 4°C.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™

Specifications

Description

Specifications

Documents