GFAP Antibody (CL2713), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP27647725UL

Catalog No. NB402780

Description

GFAP Monoclonal specifically detects GFAP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: GFAP
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: GFAP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
• Purification Method: Protein A purified
• Research Discipline: Astrocyte Markers, Cancer, Cell Biology, Cellular Markers, Chaperone Mediated Autophagy (CMA), Inflammation, Neurodegeneration, Neuroscience, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 2670.0
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Clone: CL2713
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
• Gene Alias: FLJ45472, GFAP astrocytes, glial fibrillary acidic protein
• Host Species: Mouse
• Molecular Weight of Antigen: 50 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG1