Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFAP Antibody (CL2713), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $646.00
Specifications
Antigen | GFAP |
---|---|
Clone | CL2713 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
Classification | Monoclonal |
Conjugate | Unconjugated |
Description
GFAP Monoclonal specifically detects GFAP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
GFAP | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
Mouse | |
Human, Mouse, Rat | |
FLJ45472, GFAP astrocytes, glial fibrillary acidic protein | |
GFAP | |
IgG1 | |
Protein A purified | |
50 kDa |
CL2713 | |
Monoclonal | |
Purified | |
Astrocyte Markers, Cancer, Cell Biology, Cellular Markers, Chaperone Mediated Autophagy (CMA), Inflammation, Neurodegeneration, Neuroscience, Signal Transduction, Stem Cell Markers | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
2670.0 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title