Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFER/ALR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP19018725UL
Description
GFER/ALR Polyclonal specifically detects GFER/ALR in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
GFER/ALR | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P55789 | |
GFER | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ALRFAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, EC 1.8.3.2, ERV1 homolog, ERV1hepatopoietin protein, erv1-like growth factor, growth factor, augmenter of liver regeneration, growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration), Hepatopoietin, hERV1, HERV1hepatic regenerative stimulation substance, HPO, HPO1, HPO2, HSS, truncated augmenter of liver regeneration | |
Rabbit | |
Affinity Purified | |
RUO | |
2671 | |
Human, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction