GFER/ALR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB430476	Novus Biologicals NBP19018725UL	25 μL
NBP190187	Novus Biologicals NBP190187	0.1 mL

Description

GFER/ALR Polyclonal specifically detects GFER/ALR in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GFER/ALR
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ALRFAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, EC 1.8.3.2, ERV1 homolog, ERV1hepatopoietin protein, erv1-like growth factor, growth factor, augmenter of liver regeneration, growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration), Hepatopoietin, hERV1, HERV1hepatic regenerative stimulation substance, HPO, HPO1, HPO2, HSS, truncated augmenter of liver regeneration
• Gene Symbols: GFER
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Rat
• Gene Accession No.: P55789
• Gene ID (Entrez): 2671
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only