GFM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238221

Catalog No. NBP238221

Description

GFM1 Polyclonal specifically detects GFM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GFM1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q96RP9
• Gene Symbols: GFM1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EFG, EFG1FLJ12662, EFGM, EF-Gmt, EGF1, FLJ13632, FLJ20773, G elongation factor, mitochondrial 1, G translation elongation factor, mitochondrial, GFMCOXPD1, hEFG1, mEF-G 1, mitochondrial, mitochondrial elongation factor G, mitochondrial elongation factor G1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85476
• Target Species: Human
• Isotype: IgG