Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFOD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15762120UL
Description
GFOD1 Polyclonal specifically detects GFOD1 in Human samples. It is validated for Western Blot.Specifications
GFOD1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NXC2 | |
GFOD1 | |
Synthetic peptides corresponding to GFOD1(glucose-fructose oxidoreductase domain containing 1) The peptide sequence was selected from the middle region of GFOD1. Peptide sequence NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT. | |
20 μL | |
Lipid and Metabolism | |
54438 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ADG-90, chromosome 6 open reading frame 114, FLJ20330, hypothetical protein LOC85411, Protein ADG-90, RP11-501I19.1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction