Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFOD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15762120UL
Description
GFOD1 Polyclonal specifically detects GFOD1 in Human samples. It is validated for Western Blot.Specifications
| GFOD1 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9NXC2 | |
| GFOD1 | |
| Synthetic peptides corresponding to GFOD1(glucose-fructose oxidoreductase domain containing 1) The peptide sequence was selected from the middle region of GFOD1. Peptide sequence NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT. | |
| 20 μL | |
| Lipid and Metabolism | |
| 54438 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ADG-90, chromosome 6 open reading frame 114, FLJ20330, hypothetical protein LOC85411, Protein ADG-90, RP11-501I19.1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction