Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | GFOD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1576220
|
Novus Biologicals
NBP15762120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157621
|
Novus Biologicals
NBP157621 |
100 μL |
Each for $487.50
|
|
|||||
Description
GFOD1 Polyclonal specifically detects GFOD1 in Human samples. It is validated for Western Blot.Specifications
| GFOD1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| ADG-90, chromosome 6 open reading frame 114, FLJ20330, hypothetical protein LOC85411, Protein ADG-90, RP11-501I19.1 | |
| GFOD1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NXC2 | |
| 54438 | |
| Synthetic peptides corresponding to GFOD1(glucose-fructose oxidoreductase domain containing 1) The peptide sequence was selected from the middle region of GFOD1. Peptide sequence NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title