Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFPT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$517.59
Specifications
| Antigen | GFPT2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156688
|
Novus Biologicals
NBP156688 |
100 μL |
Each for $517.59
|
|
|||||
|
NBP15668820
|
Novus Biologicals
NBP15668820UL |
20 μL | N/A | N/A | N/A | ||||
Description
GFPT2 Polyclonal specifically detects GFPT2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GFPT2 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| D-fructose-6-phosphate amidotransferase 2, FLJ10380, GFAT 2, GFAT2EC 2.6.1.16, glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2, glutamine: fructose-6-phosphate aminotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, glutamine-fructose-6-phosphate transaminase 2, Hexosephosphate aminotransferase 2 | |
| GFPT2 | |
| IgG | |
| 77 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| O94808 | |
| 9945 | |
| Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title