Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GFPT2 Antibody, Novus Biologicals™

GFPT2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15668820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15668820 20 μL
NBP156688 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15668820 Supplier Novus Biologicals Supplier No. NBP15668820UL

Description

Rabbit Polyclonal Antibody

GFPT2 Polyclonal specifically detects GFPT2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen GFPT2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Formulation From PBS. with No Preservative
Gene Accession No. O94808
Gene Alias D-fructose-6-phosphate amidotransferase 2, FLJ10380, GFAT 2, GFAT2EC 2.6.1.16, glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2, glutamine: fructose-6-phosphate aminotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, glutamine-fructose-6-phosphate transaminase 2, Hexosephosphate aminotransferase 2
Gene Symbols GFPT2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH.
Molecular Weight of Antigen 77 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 9945
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.