Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GFPT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP15668820UL

View more versions of this product

Catalog No. NBP15668820

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

GFPT2 Polyclonal specifically detects GFPT2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	GFPT2
Classification	Polyclonal
Dilution	Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.	O94808
Gene Symbols	GFPT2
Immunogen	Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH.
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	From PBS. with No Preservative
Gene Alias	D-fructose-6-phosphate amidotransferase 2, FLJ10380, GFAT 2, GFAT2EC 2.6.1.16, glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2, glutamine: fructose-6-phosphate aminotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, glutamine-fructose-6-phosphate transaminase 2, Hexosephosphate aminotransferase 2
Host Species	Rabbit
Molecular Weight of Antigen	77 kDa
Quantity	20 μL
Research Discipline	Stem Cell Markers
Gene ID (Entrez)	9945
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

GFPT2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions