GGA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214048

Catalog No. NBP214048

Description

GGA1 Polyclonal specifically detects GGA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GGA1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: ADP-ribosylation factor binding protein 1, ADP-ribosylation factor-binding protein GGA1, gamma adaptin ear containing, ARF binding protein 1, gamma-adaptin related protein 1, Gamma-adaptin-related protein 1, golgi-associated, gamma adaptin ear containing, ARF binding protein 1, Golgi-localized, gamma ear-containing, ARF-binding protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GGA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRP
• Quantity: 0.1 mL
• Research Discipline: Cell Biology, Golgi Apparatus Markers
• Gene ID (Entrez): 26088
• Target Species: Human
• Isotype: IgG

For Research Use Only