Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GGPS1 Antibody, Novus Biologicals™

GGPS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15305020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15305020 20 μL
NBP153050 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15305020 Supplier Novus Biologicals Supplier No. NBP15305020UL

Description

Rabbit Polyclonal Antibody

GGPS1 Polyclonal specifically detects GGPS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen GGPS1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95749
Gene Alias 6E)-farnesyl diphosphate synthase, Dimethylallyltranstransferase, EC 2.5.1.1, EC 2.5.1.10, EC 2.5.1.29, Farnesyl diphosphate synthase, Farnesyltranstransferase, Geranylgeranyl diphosphate synthase, geranylgeranyl diphosphate synthase 1, geranylgeranyl pyrophosphate synthase, geranyltranstransferase, GGPP synthase, GGPPS, GGPPS1farnesyltranstransferase, GGPPSase
Gene Symbols GGPS1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GGPS1(geranylgeranyl diphosphate synthase 1) The peptide sequence was selected from the middle region of GGPS1 (NP_001032354). Peptide sequence LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ.
Molecular Weight of Antigen 35 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9453
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.