Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Girdin Antibody, Novus Biologicals™

Girdin Antibody, Novus Biologicals™
SDP

Catalog No. NB396851 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396851 25 μL
NBP238387 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396851 Supplier Novus Biologicals Supplier No. NBP23838725UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Girdin Polyclonal specifically detects Girdin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Girdin
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q3V6T2
Gene Alias Akt phosphorylation enhancer, APEGIRDIN, coiled-coil domain containing 88A, Coiled-coil domain-containing protein 88A, G alpha-interacting vesicle-associated protein, G(alpha)-interacting vesicle-associated protein, Girders of actin filament, girdin, GIVFLJ10392, GRDNAKT-phosphorylation enhancer, HKRP1, HkRP1Galpha-interacting vesicle-associated protein, Hook-related protein 1, KIAA1212DKFZp686D0630
Gene Symbols CCDC88A
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPAS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55704
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.