Girdin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238387

Catalog No. NBP238387

Description

Girdin Polyclonal specifically detects Girdin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Girdin
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q3V6T2
• Gene Symbols: CCDC88A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPAS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Akt phosphorylation enhancer, APEGIRDIN, coiled-coil domain containing 88A, Coiled-coil domain-containing protein 88A, G alpha-interacting vesicle-associated protein, G(alpha)-interacting vesicle-associated protein, Girders of actin filament, girdin, GIVFLJ10392, GRDNAKT-phosphorylation enhancer, HKRP1, HkRP1Galpha-interacting vesicle-associated protein, Hook-related protein 1, KIAA1212DKFZp686D0630
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55704
• Target Species: Human
• Isotype: IgG