Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GJC3 Antibody, Novus Biologicals™

GJC3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15916220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15916220 20 μL
NBP159162 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15916220 Supplier Novus Biologicals Supplier No. NBP15916220UL

Description

Rabbit Polyclonal Antibody

GJC3 Polyclonal specifically detects GJC3 in Human samples. It is validated for Western Blot.

Specifications

Antigen GJC3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NFK1
Gene Alias connexin 29, connexin-30.2, Connexin-31.3, CX29, Cx30.2, CX30.2connexin-31.3, CX31.3, Gap junction epsilon-1 protein, gap junction gamma-3 protein, gap junction protein, epsilon 1, 29kDa, gap junction protein, gamma 3, 30.2kDa, GJE1
Gene Symbols GJC3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GJC3 The peptide sequence was selected from the C terminal of GJC3. Peptide sequence KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 349149
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.