GJD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159160

Catalog No. NBP159160

Description

GJD3 Polyclonal specifically detects GJD3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GJD3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Connexin-31.9, Cx30.2, Cx31.9, CX31.9connexin-31.9, Gap junction alpha-11 protein, Gap junction chi-1 protein, gap junction protein, chi 1, 31.9kDa, gap junction protein, delta 3, 31.9kDa, GJA11connexin 31.9, GJC1gap junction delta-3 protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 125111
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6ZUW6
• Gene Symbols: GJD3
• Immunogen: Synthetic peptides corresponding to GJC1 (gap junction protein, chi 1, 31.9kDa) The peptide sequence was selected from the N terminal of GJC1. Peptide sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 100%; Canine: 100%; Rat: 100%; Golden hamster: 100%; Chinese hamster: 100%; Mouse: 100%;.
• Target Species: Human, Mouse, Rat, Pig, Equine, Rabbit
• Form: Purified