Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GJD3 Antibody, Novus Biologicals™

GJD3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15916020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15916020 20 μL
NBP159160 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15916020 Supplier Novus Biologicals Supplier No. NBP15916020UL

Description

Rabbit Polyclonal Antibody

GJD3 Polyclonal specifically detects GJD3 in Human samples. It is validated for Western Blot.

Specifications

Antigen GJD3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6ZUW6
Gene Alias Connexin-31.9, Cx30.2, Cx31.9, CX31.9connexin-31.9, Gap junction alpha-11 protein, Gap junction chi-1 protein, gap junction protein, chi 1, 31.9kDa, gap junction protein, delta 3, 31.9kDa, GJA11connexin 31.9, GJC1gap junction delta-3 protein
Gene Symbols GJD3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GJC1 (gap junction protein, chi 1, 31.9kDa) The peptide sequence was selected from the N terminal of GJC1. Peptide sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 125111
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.