Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GK2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156691
|
Novus Biologicals
NBP156691 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GK2 Polyclonal specifically detects GK2 in Human samples. It is validated for Western Blot.Specifications
| GK2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.1.30, GK 2, GKP2, GKTAATP:glycerol 3-phosphotransferase 2, Glycerokinase 2, glycerol kinase 2, glycerol kinase pseudogene 2, glycerol kinase testis specific 2, Glycerol kinase, testis specific 2 | |
| GK2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q01415 | |
| 2712 | |
| Synthetic peptides corresponding to GK2(glycerol kinase 2) The peptide sequence was selected from the C terminal of GK2. Peptide sequence QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title