Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GK2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GK2 Polyclonal specifically detects GK2 in Human samples. It is validated for Western Blot.Specifications
GK2 | |
Polyclonal | |
Rabbit | |
Q01415 | |
2712 | |
Synthetic peptides corresponding to GK2(glycerol kinase 2) The peptide sequence was selected from the C terminal of GK2. Peptide sequence QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.7.1.30, GK 2, GKP2, GKTAATP:glycerol 3-phosphotransferase 2, Glycerokinase 2, glycerol kinase 2, glycerol kinase pseudogene 2, glycerol kinase testis specific 2, Glycerol kinase, testis specific 2 | |
GK2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title