GLI-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25753525UL

Catalog No. NB393916

Description

GLI-2 Polyclonal specifically detects GLI-2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GLI-2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: GLI family zinc finger 2, GLI-Kruppel family member GLI2, glioma-associated oncogene family zinc finger 2, HPE9tax helper protein 1, oncogene GLI2, Tax helper protein, tax helper protein 2, tax-responsive element-2 holding protein, tax-responsive element-25-bp sequence binding protein, THP, THP1, THP2, zinc finger protein GLI2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GLI2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWA
• Quantity: 25 μL
• Research Discipline: Alzheimers Research, Cancer, Cell Cycle and Replication, Neuroscience, Stem Cell Signaling Pathway
• Gene ID (Entrez): 2736
• Target Species: Human
• Form: Purified

For Research Use Only