Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLI-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | GLI-2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GLI-2 Polyclonal specifically detects GLI-2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| GLI-2 | |
| Polyclonal | |
| Rabbit | |
| Alzheimers Research, Cancer, Cell Cycle and Replication, Neuroscience, Stem Cell Signaling Pathway | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2736 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| GLI family zinc finger 2, GLI-Kruppel family member GLI2, glioma-associated oncogene family zinc finger 2, HPE9tax helper protein 1, oncogene GLI2, Tax helper protein, tax helper protein 2, tax-responsive element-2 holding protein, tax-responsive element-25-bp sequence binding protein, THP, THP1, THP2, zinc finger protein GLI2 | |
| GLI2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title