GLP-2R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159029

Catalog No. NBP159029

Description

GLP-2R Polyclonal specifically detects GLP-2R in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GLP-2R
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GLP-2 receptor, GLP-2R, GLP-2-R, glucagon-like peptide 2 receptor
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95838
• Gene Symbols: GLP2R
• Immunogen: Synthetic peptides corresponding to GLP2R(glucagon-like peptide 2 receptor) The peptide sequence was selected from the N terminal of GLP2R. Peptide sequence KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, GPCR
• Gene ID (Entrez): 9340
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.