Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLP-2R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GLP-2R |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GLP-2R Polyclonal specifically detects GLP-2R in Human samples. It is validated for Western Blot.Specifications
GLP-2R | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, GPCR | |
O95838 | |
9340 | |
Synthetic peptides corresponding to GLP2R(glucagon-like peptide 2 receptor) The peptide sequence was selected from the N terminal of GLP2R. Peptide sequence KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
GLP-2 receptor, GLP-2R, GLP-2-R, glucagon-like peptide 2 receptor | |
GLP2R | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title