Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GLS2 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, DyLight 405, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154773V

Catalog No. NBP154773V


Add to cart

Description

Description

GLS2 Polyclonal antibody specifically detects GLS2 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen).
Specifications

Specifications

GLS2
DyLight 405
50mM Sodium Borate with 0.05% Sodium Azide
EC 3.5.1.2, GAbreast cell glutaminase, GLSglutaminase GA, glutaminase 2 (liver, mitochondrial), glutaminase I, glutaminase liver isoform, mitochondrial, hLGA, LGA, L-glutaminase, L-glutamine amidohydrolase, MGC71567, phosphate-activated glutaminase, phosphate-dependent glutaminase, truncated glutaminase 2
Rabbit
IgG
100 ul
Store at 4C in the dark.
Polyclonal
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Immunohistochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Purified
GLS2
Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF.
Protein A purified
RUO
Primary
27165
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

RUO