Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GLS2 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, PerCP, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB154773PCP Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB154773PCP 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB154773PCP Supplier Novus Biologicals Supplier No. NBP154773PCP

Rabbit Polyclonal Antibody

GLS2 Polyclonal specifically detects GLS2 in Human samples. It is validated for Flow Cytometry.

Specifications

Antigen GLS2
Applications Flow Cytometry
Classification Polyclonal
Conjugate PerCP
Dilution Flow Cytometry 1:10-1:1000
Formulation PBS with 0.05% Sodium Azide
Gene Alias EC 3.5.1.2, GAbreast cell glutaminase, GLSglutaminase GA, glutaminase 2 (liver, mitochondrial), glutaminase I, glutaminase liver isoform, mitochondrial, hLGA, LGA, L-glutaminase, L-glutamine amidohydrolase, MGC71567, phosphate-activated glutaminase, phosphate-dependent glutaminase, truncated glutaminase 2
Gene Symbols GLS2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27165
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG
Show More Show Less

RUO

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.