Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168917

Catalog No. NBP168917

Description

Glucosamine (N-acetyl)-6-Sulfatase/GNS Polyclonal specifically detects Glucosamine (N-acetyl)-6-Sulfatase/GNS in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Glucosamine (N-acetyl)-6-Sulfatase/GNS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.6, EC 3.1.6.14, G6Sglucosamine-6-sulfatase, glucosamine (N-acetyl)-6-sulfatase, Glucosamine-6-sulfatase, MGC21274, N-acetylglucosamine-6-sulfatase
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5M918
• Gene Symbols: GNS
• Immunogen: Synthetic peptides corresponding to Gns (glucosamine (N-acetyl)-6-sulfatase) The peptide sequence was selected from the C terminal of Gns. Peptide sequence YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2799
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG