Glucose 6 phosphate isomerase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25852425UL

Catalog No. NB393408

Description

Glucose 6 phosphate isomerase Polyclonal specifically detects Glucose 6 phosphate isomerase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Glucose 6 phosphate isomerase
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL
• Gene Alias: AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GPI
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST
• Quantity: 25 μL
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 2821
• Target Species: Human
• Isotype: IgG

For Research Use Only