Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glucose 6 phosphate isomerase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Glucose 6 phosphate isomerase |
---|---|
Applications | Western Blot, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Glucose 6 phosphate isomerase Polyclonal specifically detects Glucose 6 phosphate isomerase in Human samples. It is validated for Western Blot.Specifications
Glucose 6 phosphate isomerase | |
Polyclonal | |
Rabbit | |
Cytokine Research | |
AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36 | |
GPI | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
2821 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title