Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB358726

Glucose Transporter GLUT6 Antibody, Biotin, Novus Biologicals™
SDP

Catalog No. NB358726 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB358726 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB358726 Supplier Novus Biologicals Supplier No. NBP159891B
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Glucose Transporter GLUT6 Polyclonal antibody specifically detects Glucose Transporter GLUT6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Glucose Transporter GLUT6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Biotin
Dilution Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS
Gene Alias Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region.
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11182
Target Species Human
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.