Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Glucose Transporter GLUT8 Antibody, Novus Biologicals™

Glucose Transporter GLUT8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1598220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1598220 20 μL
NBP159812 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1598220 Supplier Novus Biologicals Supplier No. NBP15981220UL

Description

Rabbit Polyclonal Antibody

Glucose Transporter GLUT8 Polyclonal specifically detects Glucose Transporter GLUT8 in Human samples. It is validated for Western Blot.

Specifications

Antigen Glucose Transporter GLUT8
Applications Western Blot
Classification Polyclonal
Concentration LYOPH
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NY64
Gene Alias GLUT-8, GLUT8solute carrier family 2 (facilitated glucose transporter) member 8, GLUTX1facilitated glucose transporter member 8, solute carrier family 2 (facilitated glucose transporter), member 8
Gene Symbols SLC2A8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC2A8(solute carrier family 2 (facilitated glucose transporter), member 8) The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29988
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.