Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Glucuronic Acid Epimerase Antibody, Novus Biologicals™

Glucuronic Acid Epimerase Antibody, Novus Biologicals™
SDP

Catalog No. NBP231872 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP231872 0.1 mL
NB437160 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP231872 Supplier Novus Biologicals Supplier No. NBP231872
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Glucuronic Acid Epimerase Polyclonal specifically detects Glucuronic Acid Epimerase in Human samples. It is validated for Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Glucuronic Acid Epimerase
Applications Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Flow Cytometry, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O94923
Gene Alias D-glucuronyl C5-epimerase, EC 5.1.3, EC 5.1.3.-, glucuronic acid epimerase, glucuronyl C5-epimerase, Heparin/heparan sulfate:glucuronic acid C5-epimerase, HSEPIheparin/heparan sulfate-glucuronic acid C5-epimerase, KIAA0836heparan sulfate epimerase, UDP-glucuronic acid epimerase
Gene Symbols GLCE
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ETSEGVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTVTRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLI
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26035
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.