GluR2 Rabbit anti-Human, Mouse, Rat, Clone: 9R1X2, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP315370100UL

Catalog No. NB165836

Description

GluR2 Monoclonal antibody specifically detects GluR2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: GluR2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: 9R1X2
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: AMPA 2, glutamate receptor, ionotropic, AMPA 2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GluR2 (P42262). YLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKI
• Quantity: 100 μg
• Research Discipline: Apoptosis, Cancer, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Tumor Suppressors, Vision
• Gene ID (Entrez): 2891
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG