Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GLUT12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP160023 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP160023 100 μL
NBP16002320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP160023 Supplier Novus Biologicals Supplier No. NBP160023

Rabbit Polyclonal Antibody

GLUT12 Polyclonal specifically detects GLUT12 in Human samples. It is validated for Western Blot.

Specifications

Antigen GLUT12
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TD20
Gene Alias GLUT-12, GLUT12GLUT8Glucose transporter type 12, solute carrier family 2 (facilitated glucose transporter), member 12, solute carrier family 2, facilitated glucose transporter member 12
Gene Symbols SLC2A12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC2A12(solute carrier family 2 (facilitated glucose transporter), member 12) The peptide sequence was selected from the middle region of SLC2A12. Peptide sequence FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATL The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 154091
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.