Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLUT12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16002320UL
Description
GLUT12 Polyclonal specifically detects GLUT12 in Human samples. It is validated for Western Blot.Specifications
GLUT12 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8TD20 | |
SLC2A12 | |
Synthetic peptides corresponding to SLC2A12(solute carrier family 2 (facilitated glucose transporter), member 12) The peptide sequence was selected from the middle region of SLC2A12. Peptide sequence FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGV | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
GLUT-12, GLUT12GLUT8Glucose transporter type 12, solute carrier family 2 (facilitated glucose transporter), member 12, solute carrier family 2, facilitated glucose transporter member 12 | |
Rabbit | |
Affinity Purified | |
RUO | |
154091 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction