Glut2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP169466	100 μL

Catalog No. NBP169466 Supplier Novus Biologicals Supplier No. NBP169466

Description

Rabbit Polyclonal Antibody

Glut2 Polyclonal specifically detects Glut2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Glut2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P11168
• Gene Alias: GLUT-2, GLUT2 Glucose transporter type 2, liver, SLC2A2, solute carrier family 2 (facilitated glucose transporter), member 2, solute carrier family 2, facilitated glucose transporter member 2
• Gene Symbols: SLC2A2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to SLC2A2(solute carrier family 2 (facilitated glucose transporter), member 2) The peptide sequence was selected from the N terminal of human SLC2A2. Peptide sequence ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST The peptide sequence for this immunogen was taken from within the described region.
• Molecular Weight of Antigen: 58 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6514
• Test Specificity: Expected to cross react based on sequence identity: Canine: 79%; Guinea pig: 79%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Sheep
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only