Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                GLUT9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
 
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
| Antigen | GLUT9 | 
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | 
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
Description
GLUT9 Polyclonal antibody specifically detects GLUT9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| GLUT9 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 56606 | |
| IgG | |
| Affinity purified | 
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| facilitated glucose transporter member 9, GLUT-9, GLUT9Glut9, GLUTX, solute carrier family 2 (facilitated glucose transporter), member 9, UAQTL2, urate voltage-driven efflux transporter 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
             
                                                 
                                                