GLUT9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP316970100UL

Catalog No. NB169016

Description

GLUT9 Polyclonal antibody specifically detects GLUT9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: GLUT9
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: facilitated glucose transporter member 9, GLUT-9, GLUT9Glut9, GLUTX, solute carrier family 2 (facilitated glucose transporter), member 9, UAQTL2, urate voltage-driven efflux transporter 1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
• Quantity: 100 μg
• Research Discipline: Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
• Gene ID (Entrez): 56606
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified