Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Glutamate Dehydrogenase Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

$230.50

Specifications

Product Type Recombinant Protein Antigen
Recombinant Yes
Regulatory Status RUO
Quantity 0.1mL
Storage Requirements Store at −20°C. Avoid freeze-thaw cycles.
View More Specs

Products 2
Catalog Number Mfr. No. Protein Length Price Quantity & Availability  
Catalog Number Mfr. No. Protein Length Price Quantity & Availability  
NBP254700X View Documents Novus Biologicals™
NBP254700PEP
KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN Each for $230.50
Add to cart
 
NBP254715X View Documents Novus Biologicals™
NBP254715PEP
TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL Each for $230.50
Add to cart
 
Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutamate Dehydrogenase The Glutamate Dehydrogenase Recombinant Protein Antigen is derived from E. coli. The Glutamate Dehydrogenase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Recombinant Protein Antigen
RUO
Store at −20°C. Avoid freeze-thaw cycles.
EC 1.4.1, EC 1.4.1.3, GDH 1, GDH, GDH1, GLUD
>80% by SDS-PAGE and Coomassie blue staining
Human
Blocking/Neutralizing, Control
27 kDa
Yes
0.1mL
GLUD1
GLUD1 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4
E.coli
Unlabeled
2746

For Research Use Only.

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit