Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glutaredoxin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17968920UL
Description
Glutaredoxin 2 Polyclonal specifically detects Glutaredoxin 2 in Human samples. It is validated for Western Blot.Specifications
Glutaredoxin 2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_932066 | |
GLRX2 | |
Synthetic peptide directed towards the middle region of human GLRX2. Peptide sequence NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), glutaredoxin 2, glutaredoxin-2, mitochondrial, GRX2bA101E13.1 | |
Rabbit | |
18 kDa | |
20 μL | |
Apoptosis | |
51022 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction