Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glutaredoxin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Glutaredoxin 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179689
|
Novus Biologicals
NBP179689 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP17968920
|
Novus Biologicals
NBP17968920UL |
20 μL | N/A | N/A | N/A | ||||
Description
Glutaredoxin 2 Polyclonal specifically detects Glutaredoxin 2 in Human samples. It is validated for Western Blot.Specifications
| Glutaredoxin 2 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), glutaredoxin 2, glutaredoxin-2, mitochondrial, GRX2bA101E13.1 | |
| GLRX2 | |
| IgG | |
| 18 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_932066 | |
| 51022 | |
| Synthetic peptide directed towards the middle region of human GLRX2. Peptide sequence NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title