Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glutaredoxin 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Glutaredoxin 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17968920
|
Novus Biologicals
NBP17968920UL |
20 μL |
Each for $152.22
|
|
NBP179689
|
Novus Biologicals
NBP179689 |
100 μL |
Each for $436.00
|
|
Description
Glutaredoxin 2 Polyclonal specifically detects Glutaredoxin 2 in Human samples. It is validated for Western Blot.Specifications
| Glutaredoxin 2 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| NP_932066 | |
| 51022 | |
| Synthetic peptide directed towards the middle region of human GLRX2. Peptide sequence NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), glutaredoxin 2, glutaredoxin-2, mitochondrial, GRX2bA101E13.1 | |
| GLRX2 | |
| IgG | |
| Affinity Purified | |
| 18 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title