Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Clone: 7O4Q9, Novus Biologicals™

Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Clone: 7O4Q9, Novus Biologicals™
SDP

Catalog No. NB165821 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB165821 20 μg
NB165820 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB165821 Supplier Novus Biologicals Supplier No. NBP31536220UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Glutathione Peroxidase 4/GPX4 Monoclonal antibody specifically detects Glutathione Peroxidase 4/GPX4 in Human, Mouse, Rat samples. It is validated for Western Blot, KnockDown

Specifications

Antigen Glutathione Peroxidase 4/GPX4
Applications Western Blot, KnockDown
Classification Monoclonal
Clone 7O4Q9
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Knockdown Validated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2879
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.