Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP158377

Glutathione S-Transferase mu 1/GSTM1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158377 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158377 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158377 Supplier Novus Biologicals Supplier No. NBP158377
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Glutathione S-Transferase mu 1/GSTM1 Polyclonal specifically detects Glutathione S-Transferase mu 1/GSTM1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Glutathione S-Transferase mu 1/GSTM1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P46439
Gene Alias EC 2.5.1.18, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, glutathione S-aryltransferase, glutathione S-transferase M1, glutathione S-transferase mu 1, GST class-mu 1, GST HB subunit 4, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, HB subunit 4, MGC26563, MU, MU-1, S-(hydroxyalkyl)glutathione lyase
Gene Symbols GSTM1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GSTM1(glutathione S-transferase M1) The peptide sequence was selected from the N terminal of GSTM1. Peptide sequence KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Asthma, Cancer, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 2944
Test Specificity This product recognizes Human, Mouse, Rat and Dog. Computational sequence identity: Bovine 100%; Guinea pig 100%; Golden hamster 100%; Long-tailed dwarf hamster 100%; Tetrahymena thermophila SB210 100%; Sarcoptes scabiei type hominis 100%; Crab-eating macaque 100%; Sumatran orangutan 100%; Japanese macaque 100%; Sarcoptes scabiei type suis 100%; Sarcoptes scabiei type canis 100%; Mouse 100%; Dust mite 100%; brown legged grain mite 100%; Rat 100%; Black-legged tick 100%; Caligus clemensi 100%; Blood fluke 100%; Giant panda 100%; Sheep 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.