GLYATL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179314

Catalog No. NBP179314

Description

GLYATL3 Polyclonal specifically detects GLYATL3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GLYATL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: glycine-N-acyltransferase-like 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 389396
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: XP_371825
• Gene Symbols: GLYATL3
• Immunogen: Synthetic peptide directed towards the N terminal of human C6orf140. Peptide sequence NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rat: 92%; Bovine: 92%; Canine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG