Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLYATL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | GLYATL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GLYATL3 Polyclonal specifically detects GLYATL3 in Human samples. It is validated for Western Blot.Specifications
| GLYATL3 | |
| Polyclonal | |
| Rabbit | |
| XP_371825 | |
| 389396 | |
| Synthetic peptide directed towards the N terminal of human C6orf140. Peptide sequence NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| glycine-N-acyltransferase-like 3 | |
| GLYATL3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title