Glycerol 3 Phosphate Dehydrogenase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15533220UL

Catalog No. NBP15533220

Description

Glycerol 3 Phosphate Dehydrogenase Polyclonal specifically detects Glycerol 3 Phosphate Dehydrogenase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Glycerol 3 Phosphate Dehydrogenase
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P21695
• Gene Symbols: GPD1
• Immunogen: Synthetic peptides corresponding to GPD1(glycerol-3-phosphate dehydrogenase 1 (soluble)) The peptide sequence was selected from the middle region of GPD1. Peptide sequence TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2819
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: EC 1.1.1, EC 1.1.1.8, FLJ26652, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic, glycerol-3-phosphate dehydrogenase 1 (soluble), glycerol-3-phosphate dehydrogenase, soluble, GPD-C, GPDH-C
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG