glycerol-3-phosphate permease Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18752425UL

Catalog No. NB431427

Description

glycerol-3-phosphate permease Polyclonal specifically detects glycerol-3-phosphate permease in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: glycerol-3-phosphate permease
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ22340, G-3-P permease, G-3-P transporter, G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease, glycerol-3-phosphate transporter, solute carrier family 37 (glycerol-3-phosphate transporter), member 1, Solute carrier family 37 member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54020
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC37A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only