Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
glycerol-3-phosphate permease Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | glycerol-3-phosphate permease |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
glycerol-3-phosphate permease Polyclonal specifically detects glycerol-3-phosphate permease in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
glycerol-3-phosphate permease | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
54020 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ22340, G-3-P permease, G-3-P transporter, G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease, glycerol-3-phosphate transporter, solute carrier family 37 (glycerol-3-phosphate transporter), member 1, Solute carrier family 37 member 1 | |
SLC37A1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title